Structure of PDB 4v6i Chain BQ

Receptor sequence

>4v6iBQ (length=297) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

MAFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYR
LVVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYA
TGLLIARRTLQRLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGL
QRTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIF
GGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRAD
PAFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ

3D structure

PDB

4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.

Chain

Resolution

8.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BQ	K5 S10 A11 Y12 R15 T18 R23 G26 T28 D29 Y31 Q32 R35 L36 Q39 K41 L110 T118 K120 D137 R140 F142 K143 F145 L146 I148 L150 Q151 R152 T153 G170 P174 H175 S176 R179	K5 S10 A11 Y12 R15 T18 R23 G26 T28 D29 Y31 Q32 R35 L36 Q39 K41 L110 T118 K120 D137 R140 F142 K143 F145 L146 I148 L150 Q151 R152 T153 G170 P174 H175 S176 R179
BS02	rna	BQ	A2 F3 K5 D6 S13 R15 F16 Q17 P19 F20 R21 R22 R24 E25 K27 T28 R33 N45 K48 L51 V52 V53 R54 F55 N57 K58 Q63 I65 T70 D72 V74 A77 G91 T93 N94 W95 R152 T154 G156 A157 R158 F185 F200 H203 Y207 D215 T241 H244 R248 A249 D250 A252 F253 T256 E257 F260 T261 Q264 Y265	A2 F3 K5 D6 S13 R15 F16 Q17 P19 F20 R21 R22 R24 E25 K27 T28 R33 N45 K48 L51 V52 V53 R54 F55 N57 K58 Q63 I65 T70 D72 V74 A77 G91 T93 N94 W95 R152 T154 G156 A157 R158 F185 F200 H203 Y207 D215 T241 H244 R248 A249 D250 A252 F253 T256 E257 F260 T261 Q264 Y265

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v6i, PDBe:4v6i, PDBj:4v6i
PDBsum	4v6i
PubMed	20980660
UniProt	P26321\|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]