Structure of PDB 4v5a Chain BQ

Receptor sequence

>4v5aBQ (length=136) Species: 300852 (Thermus thermophilus HB8)

RMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAARVAMV
RHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPGRVMFE
VAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ

3D structure

• PDB: 4v5a Crystal structure of the ribosome recycling factor bound to the ribosome.
• Chain: BQ
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BQ	R6 M7 K8 Y9 R10 Q12 Q13 R14 G15 K18 T21 K22 D25 Y26 Q46 A49 A53 R56 I66 R67 F69 Y74 K76 K77 E80 V81 R82 G84 K85 G86 R101 R119 H123 K124 P126 K128	R1 M2 K3 Y4 R5 Q7 Q8 R9 G10 K13 T16 K17 D20 Y21 Q41 A44 A48 R51 I61 R62 F64 Y69 K71 K72 E75 V76 R77 G79 K80 G81 R96 R114 H118 K119 P121 K123
BS02	rna	BQ	T21 E139	T16 E134

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v5a, PDBe:4v5a, PDBj:4v5a
• PDBsum: 4v5a
• PubMed: 17660830
• UniProt: P60489|RL16_THET8 Large ribosomal subunit protein uL16 (Gene Name=rplP)