Structure of PDB 1vy4 Chain BQ

Receptor sequence

>1vy4BQ (length=141) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAA
RVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPG
RVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ

3D structure

PDB

1vy4 A proton wire to couple aminoacyl-tRNA accommodation and peptide-bond formation on the ribosome.

Chain

Resolution

2.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	BQ	M1 R51 R56 R60	M1 R51 R56 R60
BS02	rna	BQ	P4 R5 R6 K8 Y9 K11 Q12 Q13 R14 G15 R16 L17 K22 G24 Y26 W41 Q45 Q46 A49 R56 R67 F69 D71 Y74 T75 K76 K77 E80 V81 R82 M83 G84 K85 G86 K87 R101 R119 H123 K124 P126 K128	P4 R5 R6 K8 Y9 K11 Q12 Q13 R14 G15 R16 L17 K22 G24 Y26 W41 Q45 Q46 A49 R56 R67 F69 D71 Y74 T75 K76 K77 E80 V81 R82 M83 G84 K85 G86 K87 R101 R119 H123 K124 P126 K128
BS03	rna	BQ	R16 L17 G19	R16 L17 G19
BS04	MG	BQ	T75 K76 G88	T75 K76 G88
BS05	MG	BQ	L125 I127	L125 I127

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:1vy4, PDBe:1vy4, PDBj:1vy4
PDBsum	1vy4
PubMed	25132179
UniProt	P60489\|RL16_THET8 Large ribosomal subunit protein uL16 (Gene Name=rplP)