Structure of PDB 7nsi Chain BP

Receptor sequence

>7nsiBP (length=288) Species: 9823 (Sus scrofa)

GPRALDLLRALPRVSLANLKPNPGSRKPERRPRGRRRGRKCGRGHKGERQ
RGTRPRLGFEGGQTPFYLRIPKYGFNEGHSFRHQYQPLSLNRLQYLIDLG
RVDPTQPIDLTQLVNGRGVTIQPSKRDYGVQLVEEGADTFKAKVNIEVQM
ASELAIAAIEKNGGVVTTAFYDPRSLEILCKPVPFFLRGQPIPKRMLPPE
ALVPYYTDAKNRGYLADPARFPEARLELARKYGYVLPDITKDELFKMLST
RKDPRQIFFGLAPGWVVNMADKKILKPTDENLLKYYSS

3D structure

• PDB: 7nsi Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
• Chain: BP
• Resolution: 4.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BP	L24 A25 L27 N30 G32 S33 R34 K35 R38 R39 P40 R41 G42 R43 R44 R47 K48 C49 G50 R51 H53 K54 G55 E56 R57 Q58 R59 T61 P63 R64 F67 E68 G69 G70 Q71 T72 Y75 L76 R77 P79 K80 H87 S88 R100 T128 Q130 S132 K133 R196 Q198	L16 A17 L19 N22 G24 S25 R26 K27 R30 R31 P32 R33 G34 R35 R36 R39 K40 C41 G42 R43 H45 K46 G47 E48 R49 Q50 R51 T53 P55 R56 F59 E60 G61 G62 Q63 T64 Y67 L68 R69 P71 K72 H79 S80 R92 T120 Q122 S124 K125 R188 Q190
BS02	MG	BP	R44 G46	R36 G38

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:1990830 cellular response to leukemia inhibitory factor

Cellular Component

• GO:0005739 mitochondrion
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7nsi, PDBe:7nsi, PDBj:7nsi
• PDBsum: 7nsi
• PubMed: 33878294
• UniProt: A0A8D0HMG9