Structure of PDB 6qx9 Chain BP

Receptor sequence
>6qx9BP (length=100) Species: 9606 (Homo sapiens) [Search protein sequence]
AKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNY
GSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYE
3D structure
PDB6qx9 Mechanism of 5' splice site transfer for human spliceosome activation.
ChainBP
Resolution3.28 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BP H4 H5 Y36 L98 H3 H4 Y35 L97
BS02 rna BP D97 E101 D96 E100
BS03 ZN BP C11 C46 C49 C85 C10 C45 C48 C84
BS04 ZN BP C23 C26 C61 C22 C25 C60
BS05 ZN BP C30 C33 C75 C29 C32 C74
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045893 positive regulation of DNA-templated transcription
GO:0048863 stem cell differentiation
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0005689 U12-type spliceosomal complex
GO:0016363 nuclear matrix
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6qx9, PDBe:6qx9, PDBj:6qx9
PDBsum6qx9
PubMed30975767
UniProtQ7RTV0|PHF5A_HUMAN PHD finger-like domain-containing protein 5A (Gene Name=PHF5A)

[Back to BioLiP]