Structure of PDB 6gz3 Chain BP

Receptor sequence

>6gz3BP (length=120) Species: 9986 (Oryctolagus cuniculus)

FRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKRLR
KAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKPEM
IGHYLGEFSITYKPVKHGRP

3D structure

• PDB: 6gz3 tRNA Translocation by the Eukaryotic 80S Ribosome and the Impact of GTP Hydrolysis.
• Chain: BP
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BP	S38 A39 R40 R42 R43 R50 R51 K77 H79 D82 Y97 G99 Y115 I121 T122 Y123 V126 K127 H128	S27 A28 R29 R31 R32 R39 R40 K66 H68 D71 Y86 G88 Y104 I110 T111 Y112 V115 K116 H117

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 22:19:20 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6gz3', asym_id = 'BP', title = 'tRNA Translocation by the Eukaryotic 80S Ribosome and the Impact of GTP Hydrolysis.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6gz3', asym_id='BP', title='tRNA Translocation by the Eukaryotic 80S Ribosome and the Impact of GTP Hydrolysis.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0015935', uniprot = '', pdbid = '6gz3', asym_id = 'BP'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0015935', uniprot='', pdbid='6gz3', asym_id='BP')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>