Structure of PDB 6c5l Chain BP

Receptor sequence

>6c5lBP (length=146) Species: 274 (Thermus thermophilus)

DLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRRFEGG
RSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELLVRAG
LLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVLLEA

3D structure

• PDB: 6c5l Conformation of methylated GGQ in the Peptidyl Transferase Center during Translation Termination.
• Chain: BP
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BP	P8 N9 N13 R15 R16 R18 G20 R21 G24 S25 G26 H27 T30 A31 T32 R33 G34 H35 K36 G37 Q38 K39 S40 S42 G43 K46 D47 P48 R50 F51 E52 G53 G54 R55 S56 L59 M60 L62 P63 K64 R65 G66 M67 Q68 G69 Q70 V71 P72 G73 E74 I75 R77 Q81 R90 L105 K107 K108 K113 L115 G116 E117 S131 K132	P4 N5 N9 R11 R12 R14 G16 R17 G20 S21 G22 H23 T26 A27 T28 R29 G30 H31 K32 G33 Q34 K35 S36 S38 G39 K42 D43 P44 R46 F47 E48 G49 G50 R51 S52 L55 M56 L58 P59 K60 R61 G62 M63 Q64 G65 Q66 V67 P68 G69 E70 I71 R73 Q77 R86 L101 K103 K104 K109 L111 G112 E113 S127 K128
BS02	MG	BP	P23 G24	P19 G20

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6c5l, PDBe:6c5l, PDBj:6c5l
• PDBsum: 6c5l
• PubMed: 29403017
• UniProt: Q5SHQ7|RL15_THET8 Large ribosomal subunit protein uL15 (Gene Name=rplO)