Structure of PDB 5aj4 Chain BP

Receptor sequence

>5aj4BP (length=288) Species: 9823 (Sus scrofa)

GPRALDLLRALPRVSLANLKPNPGSRKPERRPRGRRRGRKCGRGHKGERQ
RGTRPRLGFEGGQTPFYLRIPKYGFNEGHSFRHQYQPLSLNRLQYLIDLG
RVDPTQPIDLTQLVNGRGVTIQPSKRDYGVQLVEEGADTFKAKVNIEVQM
ASELAIAAIEKNGGVVTTAFYDPRSLEILCKPVPFFLRGQPIPKRMLPPE
ALVPYYTDAKNRGYLADPARFPEARLELARKYGYVLPDITKDELFKMLST
RKDPRQIFFGLAPGWVVNMADKKILKPTDENLLKYYSS

3D structure

• PDB: 5aj4 The complete structure of the 55S mammalian mitochondrial ribosome.
• Chain: BP
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BP	L24 A25 L27 N30 P31 G32 S33 R34 K35 E37 R39 P40 R41 G42 R43 R44 R45 R47 K48 C49 G50 R51 G52 H53 K54 G55 E56 R57 Q58 R59 R62 P63 R64 F67 E68 G69 G70 Q71 T72 Y75 L76 R77 P79 K80 H87 S88 R109 T128 Q130 S132 K133 R196 Q198	L16 A17 L19 N22 P23 G24 S25 R26 K27 E29 R31 P32 R33 G34 R35 R36 R37 R39 K40 C41 G42 R43 G44 H45 K46 G47 E48 R49 Q50 R51 R54 P55 R56 F59 E60 G61 G62 Q63 T64 Y67 L68 R69 P71 K72 H79 S80 R101 T120 Q122 S124 K125 R188 Q190

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 20:46:49 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5aj4', asym_id = 'BP', title = 'The complete structure of the 55S mammalian mitochondrial ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5aj4', asym_id='BP', title='The complete structure of the 55S mammalian mitochondrial ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0006412,0015934', uniprot = '', pdbid = '5aj4', asym_id = 'BP'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0006412,0015934', uniprot='', pdbid='5aj4', asym_id='BP')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>