Structure of PDB 4wqy Chain BP

Receptor sequence

>4wqyBP (length=82) Species: 300852 (Thermus thermophilus HB8)

MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQ

3D structure

• PDB: 4wqy Conformational Changes of Elongation Factor G on the Ribosome during tRNA Translocation.
• Chain: BP
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BP	M1 K3 R5 L6 R8 G10 S11 K12 H13 N14 H16 Y17 R18 D23 R25 R26 K27 R28 K31 Y32 I33 Y38 R42 K43 T44 V62 G63 Q65 T67 D68 T69 R72 R75 F80	M1 K3 R5 L6 R8 G10 S11 K12 H13 N14 H16 Y17 R18 D23 R25 R26 K27 R28 K31 Y32 I33 Y38 R42 K43 T44 V62 G63 Q65 T67 D68 T69 R72 R75 F80

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wqy, PDBe:4wqy, PDBj:4wqy
• PDBsum: 4wqy
• PubMed: 25594181
• UniProt: Q5SJH3|RS16_THET8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)