Structure of PDB 4v83 Chain BP

Receptor sequence
>4v83BP (length=137) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVI
RIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLY
FIRNLSDREIRRKLRADRKRIDKDRAAERAAKEEVQK
3D structure
PDB4v83 Crystal structures of complexes containing domains from two viral internal ribosome entry site (IRES) RNAs bound to the 70S ribosome.
ChainBP
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BP R41 D107 R108 R118 D122 R41 D107 R108 R118 D122
BS02 rna BP N2 R3 G4 A5 R23 R53 R54 N55 G56 N58 T60 R95 R96 A97 K98 Y100 K113 K119 K123 N2 R3 G4 A5 R23 R53 R54 N55 G56 N58 T60 R95 R96 A97 K98 Y100 K113 K119 K123
BS03 MG BP R16 T17 R16 T17
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v83, PDBe:4v83, PDBj:4v83
PDBsum4v83
PubMed21245352
UniProtQ72JU9|RL19_THET2 Large ribosomal subunit protein bL19 (Gene Name=rplS)

[Back to BioLiP]