Structure of PDB 4v7p Chain BP

Receptor sequence
>4v7pBP (length=137) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVI
RIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLY
FIRNLSDREIRRKLRADRKRIDKDRAAERAAKEEVQK
3D structure
PDB4v7p Recognition of the amber UAG stop codon by release factor RF1.
ChainBP
Resolution3.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BP D107 R108 R118 D122 D107 R108 R118 D122
BS02 rna BP N2 A5 R23 R51 R53 R54 N55 G56 N58 T60 R93 R95 R96 A97 K98 Y100 F101 K119 N2 A5 R23 R51 R53 R54 N55 G56 N58 T60 R93 R95 R96 A97 K98 Y100 F101 K119
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7p, PDBe:4v7p, PDBj:4v7p
PDBsum4v7p
PubMed20588254
UniProtQ72JU9|RL19_THET2 Large ribosomal subunit protein bL19 (Gene Name=rplS)

[Back to BioLiP]