Structure of PDB 4v6u Chain BP

Receptor sequence
>4v6uBP (length=120) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence]
MKRTGPTDPNLRRLIRYLRKKSNEYGVKIWKDVAWRLERPRRQRAEVNVS
KINRYANDGEMIVVPGSVLGAGKLEKKVIVAAWKFSETARRKIIEAGGEA
ITIEELIERNPTGSGVRIME
3D structure
PDB4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
ChainBP
Resolution6.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BP M1 R3 P6 T7 D8 R16 K20 K28 I29 D32 R36 R39 R41 R42 Q43 N48 S50 R54 Y55 S67 L69 G70 A71 S86 T88 G113 V116 R117 I118 E120 M1 R3 P6 T7 D8 R16 K20 K28 I29 D32 R36 R39 R41 R42 Q43 N48 S50 R54 Y55 S67 L69 G70 A71 S86 T88 G113 V116 R117 I118 E120
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0043232 intracellular non-membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
PDBsum4v6u
PubMed23222135
UniProtQ8U0E5|RL18E_PYRFU Large ribosomal subunit protein eL18 (Gene Name=rpl18e)

[Back to BioLiP]