Structure of PDB 4v6i Chain BP

Receptor sequence

>4v6iBP (length=193) Species: 4932 (Saccharomyces cerevisiae)

MGAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRAARPTRPDKARR
LGYKAKQGFVIYRVRVRRGNRKRPVPKGATYGKPTNQGVNELKYQRSLRA
TAEERVGRRAANLRVLNSYWVNQDSTYKYFEVILVDPQHKAIRRDARYNW
ICDPVHKHREARGLTATGKKSRGINKGHKFNNTKAGRRKTWKR

3D structure

• PDB: 4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
• Chain: BP
• Resolution: 8.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BP	M1 E8 R12 K14 R24 W28 R31 N34 V35 R44 K47 R49 R50 K54 A55 Q57 R67 R68 G69 N70 R71 K72 R73 P76 K77 G78 Y81 G82 K83 N86 E91 L92 K93 Y94 Q95 R96 S97 L98 E104 R105 R108 N112 W120 S125 Y127 Q138 H139 K140 A141 R144 W150 P154 V155 H156 K157 H158 R162 A166 K169 K170 S171 R172 G173 I174 K176 G177 H178 K179 F180 N182 R187 R188 K189 W191 K192 R193	M1 E8 R12 K14 R24 W28 R31 N34 V35 R44 K47 R49 R50 K54 A55 Q57 R67 R68 G69 N70 R71 K72 R73 P76 K77 G78 Y81 G82 K83 N86 E91 L92 K93 Y94 Q95 R96 S97 L98 E104 R105 R108 N112 W120 S125 Y127 Q138 H139 K140 A141 R144 W150 P154 V155 H156 K157 H158 R162 A166 K169 K170 S171 R172 G173 I174 K176 G177 H178 K179 F180 N182 R187 R188 K189 W191 K192 R193
BS02	rna	BP	R38 N112	R38 N112

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6i, PDBe:4v6i, PDBj:4v6i
• PDBsum: 4v6i
• PubMed: 20980660
• UniProt: P05748|RL15A_YEAST Large ribosomal subunit protein eL15A (Gene Name=RPL15A)