Structure of PDB 4v51 Chain BP

Receptor sequence

>4v51BP (length=146) Species: 300852 (Thermus thermophilus HB8)

DLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRRFEGG
RSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELLVRAG
LLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVLLEA

3D structure

• PDB: 4v51 Structure of the 70S ribosome complexed with mRNA and tRNA.
• Chain: BP
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BP	R7 P8 N9 N13 R15 R16 K17 R18 G20 R21 G24 S25 G26 H27 T30 A31 T32 R33 H35 K36 G37 Q38 K39 S40 G43 K46 D47 P48 R50 F51 E52 G53 G54 R55 S56 M60 L62 P63 K64 G66 M67 G69 Q70 V71 P72 G73 E74 R77 N84 L105 K113 L115 S131 K132 S133	R3 P4 N5 N9 R11 R12 K13 R14 G16 R17 G20 S21 G22 H23 T26 A27 T28 R29 H31 K32 G33 Q34 K35 S36 G39 K42 D43 P44 R46 F47 E48 G49 G50 R51 S52 M56 L58 P59 K60 G62 M63 G65 Q66 V67 P68 G69 E70 R73 N80 L101 K109 L111 S127 K128 S129

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v51, PDBe:4v51, PDBj:4v51
• PDBsum: 4v51
• PubMed: 16959973
• UniProt: Q5SHQ7|RL15_THET8 Large ribosomal subunit protein uL15 (Gene Name=rplO)