Structure of PDB 4v4y Chain BP

Receptor sequence
>4v4yBP (length=136) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAARVAMV
RHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPGRVMFE
VAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ
3D structure
PDB4v4y Structural basis for messenger RNA movement on the ribosome.
ChainBP
Resolution5.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BP Y9 Q13 R14 R16 L17 K18 G19 G24 Y26 F29 W41 Q46 F65 I66 F69 T75 K76 K77 E80 V81 R82 M83 G84 K85 G86 K87 I120 H123 K124 L125 Y4 Q8 R9 R11 L12 K13 G14 G19 Y21 F24 W36 Q41 F60 I61 F64 T70 K71 K72 E75 V76 R77 M78 G79 K80 G81 K82 I115 H118 K119 L120
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4y, PDBe:4v4y, PDBj:4v4y
PDBsum4v4y
PubMed17051149
UniProtP60489|RL16_THET8 Large ribosomal subunit protein uL16 (Gene Name=rplP)

[Back to BioLiP]