Structure of PDB 4v4p Chain BP

Receptor sequence

>4v4pBP (length=125) Species: 300852 (Thermus thermophilus HB8)

ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEA
EVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQ
RTRTNARTRKGPRKTVAGKKKAPRK

3D structure

• PDB: 4v4p Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.
• Chain: BP
• Resolution: 5.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BP	R93 R94	R92 R93
BS02	rna	BP	K13 R14 Y21 Y23 G24 I25 G26 K27 A28 R29 E73 R88 H92 V98 R99 G100 Q101 R102 T103 R104 T105 A107 R108 T109 R110 K111 R114 K115 T116 V117 P124 R125 K126	K12 R13 Y20 Y22 G23 I24 G25 K26 A27 R28 E72 R87 H91 V97 R98 G99 Q100 R101 T102 R103 T104 A106 R107 T108 R109 K110 R113 K114 T115 V116 P123 R124 K125
BS03	rna	BP	K120 K121 K122	K119 K120 K121
BS04	rna	BP	A118 R125	A117 R124

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v4p, PDBe:4v4p, PDBj:4v4p
• PDBsum: 4v4p
• PubMed: 15802605
• UniProt: P80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)