Structure of PDB 4v4n Chain BP

Receptor sequence

>4v4nBP (length=56) Species: 2190 (Methanocaldococcus jannaschii)

MAKADYNKRKPRKFGKGARRCIRCGQYGPIIRIQGLMLCRHCFREVAPKL
GFRKYE

3D structure

• PDB: 4v4n Structure of the SecY channel during initiation of protein translocation.
• Chain: BP
• Resolution: 9.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BP	M1 A2 K3 A4 Y6 K8 R9 K10 R12 K13 F14 C24 Q26 Y27 G28 P29 I30 I31 R32 I33 Q34 R40 H41 R44 K54 Y55 E56	M1 A2 K3 A4 Y6 K8 R9 K10 R12 K13 F14 C24 Q26 Y27 G28 P29 I30 I31 R32 I33 Q34 R40 H41 R44 K54 Y55 E56

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Mar 9 08:42:42 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4n', asym_id = 'BP', title = 'Structure of the SecY channel during initiation of protein translocation.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4n', asym_id='BP', title='Structure of the SecY channel during initiation of protein translocation.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0008270,0015935', uniprot = '', pdbid = '4v4n', asym_id = 'BP'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0008270,0015935', uniprot='', pdbid='4v4n', asym_id='BP')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>