Structure of PDB 8ove Chain BO

Receptor sequence

>8oveBO (length=221) Species: 5702 (Trypanosoma brucei brucei)

VLPSRRSLNRSSRKGFKKHRPDIIVIDLKDHVLGRAAAIVAKQLLLGKKI
TVVRCEKLTIAGSEIRNKIKYLQFLRKRKLSNPKLGPFHHRSPSDVFIRT
VRSMLPRYTKRGQRALRQLVAYEGVPVNVVRTGGRVVIPKAQRHNCYRNE
RRFTVLGNMCKHVGWKYSDVVEKLEAARIEKSGRHHKKMEKVRVAWKNAR
KEALKKMPQKNVEVLKKFGLA

3D structure

• PDB: 8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
• Chain: BO
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BO	G35 R36 K43 I66 R67 I70 K71 Q74 R77 K78 R79 K80 M105 P107 Y109 K111 K141 C147 Y148 R149 R152	G34 R35 K42 I65 R66 I69 K70 Q73 R76 K77 R78 K79 M104 P106 Y108 K110 K140 C146 Y147 R148 R151
BS02	rna	BO	R11 K19 H20 P22 K50 I51 N83 L86 P88 F89 R103 R108 Y109 Q119 V121 Y123 E124 N129 R132 K182 R185 H186 K189	R10 K18 H19 P21 K49 I50 N82 L85 P87 F88 R102 R107 Y108 Q118 V120 Y122 E123 N128 R131 K181 R184 H185 K188
BS03	rna	BO	R11 F17 K19 H20 K30 R55 V131 R132 G134 R136 H145 R179 H187 R194 W197 R201 K211	R10 F16 K18 H19 K29 R54 V130 R131 G133 R135 H144 R178 H186 R193 W196 R200 K210
BS04	rna	BO	V2 L3 P4 S5 R6 R7 K69 R79 P84 H90 H91 R92 R153 H163 V164 G165 K167 Y168	V1 L2 P3 S4 R5 R6 K68 R78 P83 H89 H90 R91 R152 H162 V163 G164 K166 Y167

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ove, PDBe:8ove, PDBj:8ove
• PDBsum: 8ove
• PubMed: 37985661
• UniProt: Q585J5