Structure of PDB 8oit Chain BO

Receptor sequence

>8oitBO (length=202) Species: 9606 (Homo sapiens) [Search protein sequence]

TVIVERWWKVPLAGEGRKPRLHRRHRVYKLVEDTKHRPKENLELILTQSV
ENVGVRGDLVSVKKSLGRNRLLPQGLAVYASPENKKLFEEEKLLRQEGKL
EKIQTKAGEATVKFLKSCRLEVGMKNNVKWELNPEIVARHFFKNLGVVVA
PHTLKLPEEPITRWGEYWCEVTVNGLDTVRVPMSVVNFEKPKTKRYKYWL
AQ

3D structure

PDB

8oit Molecular basis of translation termination at noncanonical stop codons in human mitochondria.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BO	W60 P63 L64 G66 R69 R72 H74 R75 R76 R78 D85 K87 H88 K177 N178 N179 N239 F240 E241 K242 P243 K244 T245 R247 Y248 K249 W251 L252	W8 P11 L12 G14 R17 R20 H22 R23 R24 R26 D33 K35 H36 K125 N126 N127 N187 F188 E189 K190 P191 K192 T193 R195 Y196 K197 W199 L200

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005761	mitochondrial ribosome
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8oit, PDBe:8oit, PDBj:8oit
PDBsum	8oit
PubMed	37141370
UniProt	Q9BYD2\|RM09_HUMAN Large ribosomal subunit protein bL9m (Gene Name=MRPL9)

[Back to BioLiP]