Structure of PDB 8jiw Chain BO

Receptor sequence

>8jiwBO (length=130) Species: 4565 (Triticum aestivum) [Search protein sequence]

REGEHVFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSP
YAAMLASQDVATRCKELGITALHIKLRATGGNKTKTPGPGAQSALRALAR
SGMKIGRIEDVTPVPTDSTRRKGGRRGRRL

3D structure

PDB

8jiw Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.

Chain

Resolution

2.88 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BO	H32 N38 D39 F41 H43 S48 G49 R50 E51 T52 R55 T57 G59 M60 D65 R66 E68 V135 P136 T137 D138 T140 R141 K143 G145 R146 R147 R149 R150	H11 N17 D18 F20 H22 S27 G28 R29 E30 T31 R34 T36 G38 M39 D44 R45 E47 V114 P115 T116 D117 T119 R120 K122 G124 R125 R126 R128 R129

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links