Structure of PDB 8evs Chain BO

Receptor sequence

>8evsBO (length=127) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAA
MLAAQDVAAKCKEVGITAVHVKIRATGGTRTKTPGPGGQAALRALARSGL
RIGRIEDVTPVPSDSTRKKGGRRGRRL

3D structure

PDB

8evs Regulation of translation by ribosomal RNA pseudouridylation.

Chain

Resolution

2.62 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	BO	R18 N24 D25 F27 H29 G35 K36 T38 R41 T43 G45 M46 K49 A50 D51 R52 E54 G88 V121 P122 S123 D124 S125 T126 R127 K129 G130 R135 R136	R8 N14 D15 F17 H19 G25 K26 T28 R31 T33 G35 M36 K39 A40 D41 R42 E44 G78 V111 P112 S113 D114 S115 T116 R117 K119 G120 R125 R126
BS02	U	BO	R133 R136	R123 R126
BS03	C	BO	R127 R132	R117 R122
BS04	U	BO	R136 L137	R126 L127
BS05	G	BO	R127 R132	R117 R122

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:0032040	small-subunit processome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8evs, PDBe:8evs, PDBj:8evs
PDBsum	8evs
PubMed	37595043
UniProt	P06367\|RS14A_YEAST Small ribosomal subunit protein uS11A (Gene Name=RPS14A)