Structure of PDB 7zs5 Chain BO

Receptor sequence

>7zs5BO (length=203) Species: 4932 (Saccharomyces cerevisiae)

GAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRAARPTRPDKARRL
GYKAKQGFVIYRVRVRRGNRKRPVPKGATYGKPTNQGVNELKYQRSLRAT
AEERVGRRAANLRVLNSYWVNQDSTYKYFEVILVDPQHKAIRRDARYNWI
CDPVHKHREARGLTATGKKSRGINKGHKFNNTKAGRRKTWKRQNTLSLWR
YRK

3D structure

• PDB: 7zs5 Structural basis for clearing of ribosome collisions by the RQT complex.
• Chain: BO
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BO	G2 Y4 E8 R12 K14 R24 W28 R31 N34 V35 R41 R44 K47 R49 R50 L51 K54 A55 K56 R67 R68 G69 N70 R71 K72 R73 P74 K77 G78 Y81 G82 K83 P84 T85 Q87 N90 E91 K93 Y94 Q95 R96 S97 R105 A111 N112 W120 S125 Y127 Q138 K140 R147 W150 H156 K157 A161 R162 L164 A166 K169 K170 S171 R172 I174 K176 G177 H178 K179 F180 N181 R187 R188 K189 W191 K192 R193 Q194 W200 Y202 R203	G1 Y3 E7 R11 K13 R23 W27 R30 N33 V34 R40 R43 K46 R48 R49 L50 K53 A54 K55 R66 R67 G68 N69 R70 K71 R72 P73 K76 G77 Y80 G81 K82 P83 T84 Q86 N89 E90 K92 Y93 Q94 R95 S96 R104 A110 N111 W119 S124 Y126 Q137 K139 R146 W149 H155 K156 A160 R161 L163 A165 K168 K169 S170 R171 I173 K175 G176 H177 K178 F179 N180 R186 R187 K188 W190 K191 R192 Q193 W199 Y201 R202
BS02	rna	BO	R38 Q57 Y62 R109 N112 H139	R37 Q56 Y61 R108 N111 H138

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7zs5, PDBe:7zs5, PDBj:7zs5
• PDBsum: 7zs5
• PubMed: 36801861
• UniProt: P05748|RL15A_YEAST Large ribosomal subunit protein eL15A (Gene Name=RPL15A)