Structure of PDB 4v9q Chain BO

Receptor sequence
>4v9qBO (length=88) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
3D structure
PDB4v9q Blasticidin S inhibits translation by trapping deformed tRNA on the ribosome.
ChainBO
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna BO H53 V60 G89 H52 V59 G88
BS02 rna BO P2 K8 F18 D21 T22 G23 Q28 L31 R35 R38 L39 H42 H46 D49 H50 H51 S52 R54 G55 M58 M59 R64 R65 Y69 R72 P1 K7 F17 D20 T21 G22 Q27 L30 R34 R37 L38 H41 H45 D48 H49 H50 S51 R53 G54 M57 M58 R63 R64 Y68 R71
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v9q, PDBe:4v9q, PDBj:4v9q
PDBsum4v9q
PubMed23824292
UniProtP62657|RS15_THET2 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]