Structure of PDB 4v9m Chain BO

Receptor sequence
>4v9mBO (length=122) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRG
AVKEGDVVKAVVVRTKKEIKRPDGSAIRFDDNAAVIINNQLEPRGTRVFG
PVARELREKGFMKIVSLAPEVL
3D structure
PDB4v9m Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
ChainBO
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna BO P48 R49 R97 V115 S116 P48 R49 R97 V115 S116
BS02 rna BO M1 Q3 Q5 T6 Y7 I22 R23 S28 N29 A30 K31 V40 S42 K44 V57 K66 K67 K70 M1 Q3 Q5 T6 Y7 I22 R23 S28 N29 A30 K31 V40 S42 K44 V57 K66 K67 K70
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v9m, PDBe:4v9m, PDBj:4v9m
PDBsum4v9m
PubMed23812722
UniProtQ72I14|RL14_THET2 Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]