Structure of PDB 4v4t Chain BO

Receptor sequence
>4v4tBO (length=122) Species: 274 (Thermus thermophilus) [Search protein sequence]
MIQQESRLKVADNSGAREVLVIKVLGGSGRRYANIGDVVVATVKDATPGG
VVKKGQVVKAVVVRTKRGVRRPDGSYIRFDENACVIIRDDKSPRGTRIFG
PVARELRDKDFMKIISLAPEVI
3D structure
PDB4v4t Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
ChainBO
Resolution6.46 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BO P48 R97 P48 R97
BS02 rna BO Q4 E5 S6 I22 K23 G27 S28 R30 R31 V40 K66 R67 R70 Y76 R78 Q4 E5 S6 I22 K23 G27 S28 R30 R31 V40 K66 R67 R70 Y76 R78
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4t, PDBe:4v4t, PDBj:4v4t
PDBsum4v4t
PubMed16377566
UniProtQ5L413|RL14_GEOKA Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]