Structure of PDB 4v49 Chain BO

Receptor sequence
>4v49BO (length=117) Species: 562 (Escherichia coli) [Search protein sequence]
PRAKTGIVRRRRHKKVLKRAKGFWGSRSKQYRNAFQTLLNAATYEYRDRR
NKKRDFRRLWIQRINAGARLHGMNYSTFINGLKRANIDLNRKVLADIAAR
EPEAFKALVDASRNARQ
3D structure
PDB4v49 X-ray Crystal Structures of the WT and a Hyper-Accurate Ribosome From Escherichia Coli
ChainBO
Resolution8.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna BO P2 R3 Q31 R33 P1 R2 Q30 R32
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Wed Apr 30 03:00:20 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v49', asym_id = 'BO', title = 'X-ray Crystal Structures of the WT and a Hyper-Accurate Ribosome From Escherichia Coli'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v49', asym_id='BO', title='X-ray Crystal Structures of the WT and a Hyper-Accurate Ribosome From Escherichia Coli')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '4v49', asym_id = 'BO'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='4v49', asym_id='BO')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>