Structure of PDB 8ove Chain BN

Receptor sequence

>8oveBN (length=210) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

PKGNNAIPHVHQRKHWNPCSSQKGNVKVFFNQPAQKQRRRRLRLLKAKKI
FPRPLKALRPQVNCPTVRYNMKRRLGRGFSLEELKAAGVKPRYARTIGIR
VDRRRKNKSEEGMNINVQRLKTYMSKLVLFPLNRKKPQKGDATEEEVKAA
TQDRSRYGTAAVGGLVTPAREAPRKVTEEESTKKMYKFLKKNHSAVRFFR
ARNRRAARKE

3D structure

PDB

8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	BN	P2 K3 H12 Q13 R14 K15 H16 S22 Q23 K24 G25 N26 V27 Q33 K37 R40 R41 R44 K47 R54 V63 N64 P66 T67 Y70 N71 R75 R78 R96 R101 D103 R105 S110 R135 R157 Y158 K185 Y187 K191 H194 R198	P1 K2 H11 Q12 R13 K14 H15 S21 Q22 K23 G24 N25 V26 Q32 K36 R39 R40 R43 K46 R53 V62 N63 P65 T66 Y69 N70 R74 R77 R95 R100 D102 R104 S109 R134 R156 Y157 K184 Y186 K190 H193 R197
BS02	rna	BN	S195 F199 R201 R203 R206	S194 F198 R200 R202 R205
BS03	rna	BN	A35 R39	A34 R38

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum	8ove
PubMed	37985661
UniProt	Q57V55

[Back to BioLiP]