Structure of PDB 8oit Chain BN

Receptor sequence

>8oitBN (length=252) Species: 9606 (Homo sapiens)

PEPVLRKVELPVPTHRRPVQAWVESLRGFEQERVGLADLHPDVFATAPRL
DILHQVAMWQKNFKRISYAKTKTRAEVRGGGRKPWPQKGTGRARHGSIRS
PLWRGGGVAHGPRGPTSYYYMLPMKVRALGLKVALTVKLAQDDLHIMDSL
ELPTGDPQYLTELAHYRRWGDSVLLVDLTHEEMPQSIVEATSRLKTFNLI
PAVGLNVHSMLKHQTLVLTLPTVAFLEDKLLWQDSRYRPLYPFSLPYSDF
PR

3D structure

• PDB: 8oit Molecular basis of translation termination at noncanonical stop codons in human mitochondria.
• Chain: BN
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BN	R92 H97 M101 K104 N105 R108 S110 Y111 A112 K113 T114 K115 R117 A118 V120 R121 G122 R125 K126 Q130 K131 G132 G134 R135 A136 R137 H138 G139 R142 S143 P144 L145 W146 R147 G148 V151 H153 P155 P158 Y161 Y163 M164 P166 M167 K168 V169 R170 K255 R281 P282 Y284 P285	R49 H54 M58 K61 N62 R65 S67 Y68 A69 K70 T71 K72 R74 A75 V77 R78 G79 R82 K83 Q87 K88 G89 G91 R92 A93 R94 H95 G96 R99 S100 P101 L102 W103 R104 G105 V108 H110 P112 P115 Y118 Y120 M121 P123 M124 K125 V126 R127 K212 R238 P239 Y241 P242

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8oit, PDBe:8oit, PDBj:8oit
• PDBsum: 8oit
• PubMed: 37141370
• UniProt: Q9BYD3|RM04_HUMAN Large ribosomal subunit protein uL4m (Gene Name=MRPL4)