Structure of PDB 8c3a Chain BN

Receptor sequence

>8c3aBN (length=170) Species: 5476 (Candida albicans) [Search protein sequence]

RLNEYQVIGRNLPTESVPEPKLFRMRIFAPNTVVAKSRYWYFLQKLHKVK
KASGEIVSVNIISEAKPTKVKTFGIWLRYESRSGIHNMYKEYRDVTRVGA
VETMYQDLAARHRARFRSIHILKVVELEKTDDVKRQYVKQFLTKDLKFPL
PHRVQKSKKLFQATAPTTFY

3D structure

PDB

8c3a New crystal system to promote screening for new eukaryotic inhibitors

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BN	N62 S65 E66 K68 P69 K71 S83 R84 S85 H88 N89 M90 Y91 K92 Q108 A111 A112 R113 H114 R115 R117 T132 R137 Y139 L144 T145 K146 H154 R155 Q157 K158 S159 K161 Q164 A165 A167 P168 T169 T170 F171	N60 S63 E64 K66 P67 K69 S81 R82 S83 H86 N87 M88 Y89 K90 Q106 A109 A110 R111 H112 R113 R115 T130 R135 Y137 L142 T143 K144 H152 R153 Q155 K156 S157 K159 Q162 A163 A165 P166 T167 T168 F169
BS02	rna	BN	S39 R40 Y43 Q46 H49 K50 K52 K53 R84 R117 R119	S37 R38 Y41 Q44 H47 K48 K50 K51 R82 R115 R117

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8c3a, PDBe:8c3a, PDBj:8c3a
PDBsum	8c3a
PubMed
UniProt	A0A8H6BZJ3

[Back to BioLiP]