Structure of PDB 7pqd Chain BN

Receptor sequence

>7pqdBN (length=37) Species: 272943 (Cereibacter sphaeroides 2.4.1)

TDEQAQELHSVYMSGLWLFSAVAIVAHLAVYIWRPWF

3D structure

• PDB: 7pqd Cryo-EM structure of the dimeric Rhodobacter sphaeroides RC-LH1 core complex at 2.9 angstrom : the structural basis for dimerisation.
• Chain: BN
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	BN	F31 A35 H39 V42 W48	F19 A23 H27 V30 W36

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 01:51:15 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7pqd', asym_id = 'BN', title = 'Cryo-EM structure of the dimeric Rhodobacter sph...ngstrom : the structural basis for dimerisation. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7pqd', asym_id='BN', title='Cryo-EM structure of the dimeric Rhodobacter sph...ngstrom : the structural basis for dimerisation. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016020,0019684,0030077,0045156', uniprot = '', pdbid = '7pqd', asym_id = 'BN'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016020,0019684,0030077,0045156', uniprot='', pdbid='7pqd', asym_id='BN')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>