Structure of PDB 6th6 Chain BN

Receptor sequence
>6th6BN (length=81) Species: 69014 (Thermococcus kodakarensis KOD1) [Search protein sequence]
PAIEVGRIAVVIAGRRAGQKVVVADIIDKNFVLVTGAGLNKVKRRRMNVK
HLEPLPERVNIQRGASDEEIKAALEGAGISL
3D structure
PDB6th6 Dynamic RNA acetylation revealed by quantitative cross-evolutionary mapping.
ChainBN
Resolution2.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BN G15 R16 R17 N31 R46 R47 M48 N49 K51 H52 G14 R15 R16 N30 R45 R46 M47 N48 K50 H51
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6th6, PDBe:6th6, PDBj:6th6
PDBsum6th6
PubMed32555463
UniProtQ5JJE4|RL14E_THEKO Large ribosomal subunit protein eL14 (Gene Name=rpl14e)

[Back to BioLiP]