Structure of PDB 6i7o Chain BN

Receptor sequence

>6i7oBN (length=112) Species: 4932 (Saccharomyces cerevisiae)

AQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSAL
QGISTLRPRQYATVSKTHKTVSRAYGGSRCANCVKERIIRAFLIEEQKIV
KKVVKEQTEAAK

3D structure

• PDB: 6i7o Collided ribosomes form a unique structural interface to induce Hel2-driven quality control pathways.
• Chain: BN
• Resolution: 5.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BN	A2 R4 V5 F7 R8 R9 R10 N11 P12 Y13 N14 S17 K19 K24 T25 P26 R31 Q33 K37 T40 R41 K43 G45 Q52 G53 I54 S55 T56 R58 P59 R60 A63 S66 K67 T68 K70 T71 V72 S73 R74 Y76 G78 S79 R80 R88 R91 A92 I95 E96 Q98 K99 K102 K106 E110 K113	A1 R3 V4 F6 R7 R8 R9 N10 P11 Y12 N13 S16 K18 K23 T24 P25 R30 Q32 K36 T39 R40 K42 G44 Q51 G52 I53 S54 T55 R57 P58 R59 A62 S65 K66 T67 K69 T70 V71 S72 R73 Y75 G77 S78 R79 R87 R90 A91 I94 E95 Q97 K98 K101 K105 E109 K112

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6i7o, PDBe:6i7o, PDBj:6i7o
• PDBsum: 6i7o
• PubMed: 30609991
• UniProt: P87262|RL34A_YEAST Large ribosomal subunit protein eL34A (Gene Name=RPL34A)