Structure of PDB 5aa0 Chain BN

Receptor sequence
>5aa0BN (length=98) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRG
PFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
3D structure
PDB5aa0 Structure of Bipa in GTP Form Bound to the Ratcheted Ribosome.
ChainBN
Resolution5.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BN R5 K7 R9 H13 S35 G36 I38 L40 P41 R43 V44 R45 R51 G52 P53 F54 K55 H56 K57 S59 E61 R3 K5 R7 H11 S33 G34 I36 L38 P39 R41 V42 R43 R49 G50 P51 F52 K53 H54 K55 S57 E59
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5aa0, PDBe:5aa0, PDBj:5aa0
PDBsum5aa0
PubMed26283392
UniProtQ5SHN7|RS10_THET8 Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]