Structure of PDB 4v9k Chain BN

Receptor sequence

>4v9kBN (length=138) Species: 262724 (Thermus thermophilus HB27)

MKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGD
FVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLE
HAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKL

3D structure

• PDB: 4v9k Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
• Chain: BN
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BN	T3 V5 T22 G24 R25 T28 R35 K37 N45 T63 G64 K66 Q69 K70 Y72 R74 Y75 S76 Y78 G80 L82 R97 A102 G105 M106 P108 K109 G110 P111 L112 R114 K118 Q131	T3 V5 T22 G24 R25 T28 R35 K37 N45 T63 G64 K66 Q69 K70 Y72 R74 Y75 S76 Y78 G80 L82 R97 A102 G105 M106 P108 K109 G110 P111 L112 R114 K118 Q131

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v9k, PDBe:4v9k, PDBj:4v9k
• PDBsum: 4v9k
• PubMed: 23812722
• UniProt: Q72IN1|RL13_THET2 Large ribosomal subunit protein uL13 (Gene Name=rplM)