Structure of PDB 4v92 Chain BN

Receptor sequence
>4v92BN (length=150) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]
GRMHSAGKGISSSAIPYSRNAPAWFKLSSESVIEQIVKYARKGLTPSQIG
VLLRDAHGVTQARVITGNKIMRILKSNGLAPEIPEDLYYLIKKAVSVRKH
LERNRKDKDAKFRLILIESRIHRLARYYRTVAVLPPNWKYESATASALVN
3D structure
PDB4v92 Initiation of Translation by Cricket Paralysis Virus Ires Requires its Translocation in the Ribosome.
ChainBN
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BN G2 R3 M4 H5 S6 A7 G8 K9 G10 I11 S12 S13 S14 K94 H101 R106 K107 D108 K109 D110 A111 K112 R114 I118 R121 G1 R2 M3 H4 S5 A6 G7 K8 G9 I10 S11 S12 S13 K93 H100 R105 K106 D107 K108 D109 A110 K111 R113 I117 R120
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Dec 3 04:44:52 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v92', asym_id = 'BN', title = 'Initiation of Translation by Cricket Paralysis V... Ires Requires its Translocation in the Ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v92', asym_id='BN', title='Initiation of Translation by Cricket Paralysis V... Ires Requires its Translocation in the Ribosome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v92', asym_id = 'BN'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v92', asym_id='BN')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>