Structure of PDB 4v8z Chain BN

Receptor sequence

>4v8zBN (length=203) Species: 4932 (Saccharomyces cerevisiae)

GAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRAARPTRPDKARRL
GYKAKQGFVIYRVRVRRGNRKRPVPKGATYGKPTNQGVNELKYQRSLRAT
AEERVGRRAANLRVLNSYWVNQDSTYKYFEVILVDPQHKAIRRDARYNWI
CDPVHKHREARGLTATGKKSRGINKGHKFNNTKAGRRKTWKRQNTLSLWR
YRK

3D structure

• PDB: 4v8z Molecular architecture of a eukaryotic translational initiation complex.
• Chain: BN
• Resolution: 6.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BN	G2 Y4 K5 R12 K14 R31 N34 V35 A40 R41 K47 R49 A55 Q57 R67 R68 N70 R71 K72 R73 P74 V75 P76 K77 G78 Y81 G82 K83 N86 Q87 N90 E91 K93 Y94 Q95 R105 A111 N112 S125 Y127 Q138 H139 K140 A141 R144 R147 P154 V155 H158 A161 R162 A166 K169 K170 S171 R172 I174 K176 H178 K179 N181 N182 K184 G186 R187 R188 K189 W191 K192 R193 Q194 S198 W200 R201 Y202 R203 K204	G1 Y3 K4 R11 K13 R30 N33 V34 A39 R40 K46 R48 A54 Q56 R66 R67 N69 R70 K71 R72 P73 V74 P75 K76 G77 Y80 G81 K82 N85 Q86 N89 E90 K92 Y93 Q94 R104 A110 N111 S124 Y126 Q137 H138 K139 A140 R143 R146 P153 V154 H157 A160 R161 A165 K168 K169 S170 R171 I173 K175 H177 K178 N180 N181 K183 G185 R186 R187 K188 W190 K191 R192 Q193 S197 W199 R200 Y201 R202 K203
BS02	rna	BN	R38 Q57 G58 V60 Y62 R109 A110 N112 L113 D136 H139	R37 Q56 G57 V59 Y61 R108 A109 N111 L112 D135 H138

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8z, PDBe:4v8z, PDBj:4v8z
• PDBsum: 4v8z
• PubMed: 24200810
• UniProt: P05748|RL15A_YEAST Large ribosomal subunit protein eL15A (Gene Name=RPL15A)