Structure of PDB 4v87 Chain BN

Receptor sequence
>4v87BN (length=119) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYA
AQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVD
DTPVPHNGCRPKKKFRKAS
3D structure
PDB4v87 A new understanding of the decoding principle on the ribosome.
ChainBN
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BN K11 Y20 N26 N27 I29 T31 N38 P39 W42 S44 G46 V47 G52 S53 K55 R85 V114 P115 H116 N117 G118 C119 R120 K122 K123 K124 K1 Y10 N16 N17 I19 T21 N28 P29 W32 S34 G36 V37 G42 S43 K45 R75 V104 P105 H106 N107 G108 C109 R110 K112 K113 K114
BS02 MG BN N26 G52 N16 G42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v87, PDBe:4v87, PDBj:4v87
PDBsum4v87
PubMed22437501
UniProtP80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]