Structure of PDB 4v4y Chain BN

Receptor sequence
>4v4yBN (length=122) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRG
AVKEGDVVKAVVVRTKKEVKRPDGSAIRFDDNAAVIINNQLEPRGTRVFG
PVARELREKGFMKIVSLAPEVL
3D structure
PDB4v4y Structural basis for messenger RNA movement on the ribosome.
ChainBN
Resolution5.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BN R49 E120 R49 E120
BS02 rna BN M1 I2 Q3 Q5 T6 Y7 I22 R23 K26 G27 S28 N29 K31 Y32 T65 K66 K67 D81 M1 I2 Q3 Q5 T6 Y7 I22 R23 K26 G27 S28 N29 K31 Y32 T65 K66 K67 D81
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4y, PDBe:4v4y, PDBj:4v4y
PDBsum4v4y
PubMed17051149
UniProtP60558|RL14_THETH Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]