Structure of PDB 4v4t Chain BN

Receptor sequence
>4v4tBN (length=117) Species: 274 (Thermus thermophilus) [Search protein sequence]
AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQI
VEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPKKQRGREAFESVRVY
LGNPYDTLGEISETLGA
3D structure
PDB4v4t Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
ChainBN
Resolution6.46 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BN A4 E5 F6 I18 M19 R21 E28 I46 T47 R49 Q52 Y57 R60 N65 Y69 F70 K80 R81 T82 M86 L87 K90 K91 Q92 R95 E99 A1 E2 F3 I15 M16 R18 E25 I43 T44 R46 Q49 Y54 R57 N62 Y66 F67 K77 R78 T79 M83 L84 K86 K87 Q88 R91 E95
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0017148 negative regulation of translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4t, PDBe:4v4t, PDBj:4v4t
PDBsum4v4t
PubMed16377566
UniProtP29198|RL13_HALMA Large ribosomal subunit protein uL13 (Gene Name=rpl13)

[Back to BioLiP]