Structure of PDB 3j9w Chain BN

Receptor sequence
>3j9wBN (length=122) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQATPGG
VVKKGEVVKAVIVRTKSGARRSDGSYISFDENACVIIRDDKSPRGTRIFG
PVARELRENNFMKIVSLAPEVI
3D structure
PDB3j9w Structure of the Bacillus subtilis 70S ribosome reveals the basis for species-specific stalling.
ChainBN
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BN P48 K54 R97 P48 K54 R97
BS02 rna BN M1 Q3 Q4 T6 R7 I22 L25 G27 S28 G29 R30 K31 V40 T42 K44 V57 K59 K66 R70 Y76 N82 M1 Q3 Q4 T6 R7 I22 L25 G27 S28 G29 R30 K31 V40 T42 K44 V57 K59 K66 R70 Y76 N82
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j9w, PDBe:3j9w, PDBj:3j9w
PDBsum3j9w
PubMed25903689
UniProtP12875|RL14_BACSU Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]