Structure of PDB 1vy6 Chain BN

Receptor sequence

>1vy6BN (length=140) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGD
FVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLE
HAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV

3D structure

PDB

1vy6 A proton wire to couple aminoacyl-tRNA accommodation and peptide-bond formation on the ribosome.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BN	K2 T3 G24 R25 T28 R35 K37 N45 F51 T63 K65 K66 Q69 K70 R74 Y75 S76 Y78 P79 G80 L82 K83 K89 H94 R97 E100 H101 A102 G105 M106 P108 K109 P111 L112 R114 F117 K118 K121 H130 Q133	K2 T3 G24 R25 T28 R35 K37 N45 F51 T63 K65 K66 Q69 K70 R74 Y75 S76 Y78 P79 G80 L82 K83 K89 H94 R97 E100 H101 A102 G105 M106 P108 K109 P111 L112 R114 F117 K118 K121 H130 Q133
BS02	MG	BN	G64 K65 K66 L67	G64 K65 K66 L67

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:1vy6, PDBe:1vy6, PDBj:1vy6
PDBsum	1vy6
PubMed	25132179
UniProt	P60488\|RL13_THET8 Large ribosomal subunit protein uL13 (Gene Name=rplM)