Structure of PDB 8oit Chain BM

Receptor sequence

>8oitBM (length=305) Species: 9606 (Homo sapiens) [Search protein sequence]

KSGTWWDEHLSEENVPFIKQLVSDEDKAQLASKLCPLKDEPWPIHPWEPG
SFRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGKMA
TLSVGGKTVSRFRKATSILEFYRELGLPPKQTVKIFNITDNAAIKPGTPL
YAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPATHGQTKTHRRPGAV
ATGDIGRVWPGTKMPGKMGNIYRTEYGLKVWRINTKHNIIYVNGSVPGHK
NCLVKVKDSKLPAYKDLGKNLPFPTYFPDGDEEELPEDLYDENVCQPGAP
SITFA

3D structure

PDB

8oit Molecular basis of translation termination at noncanonical stop codons in human mitochondria.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BM	T47 W48 W49 D50 V65 D69 M106 P108 V118 M142 S153 R154 F155 R156 A158 T159 I161 Y165 V176 K177 I178 N180 T210 I211 G212 K213 G214 F215 G217 R221 F224 K225 G226 P228 T230 H231 G232 Q233 T234 K235 T236 H237 R238 R239 P240 G241 A242 V243 A244 T245 G246 D247 I248 G249 R250 V251 W252 P253 G254 T255 M257 P258 K260 I264 Y265 R266 E268 Y269 G287 S288 V289 G291 H292 N294 K298 K300 K303 L304 P305	T4 W5 W6 D7 V22 D26 M63 P65 V75 M99 S110 R111 F112 R113 A115 T116 I118 Y122 V133 K134 I135 N137 T167 I168 G169 K170 G171 F172 G174 R178 F181 K182 G183 P185 T187 H188 G189 Q190 T191 K192 T193 H194 R195 R196 P197 G198 A199 V200 A201 T202 G203 D204 I205 G206 R207 V208 W209 P210 G211 T212 M214 P215 K217 I221 Y222 R223 E225 Y226 G244 S245 V246 G248 H249 N251 K255 K257 K260 L261 P262

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8oit, PDBe:8oit, PDBj:8oit
PDBsum	8oit
PubMed	37141370
UniProt	P09001\|RM03_HUMAN Large ribosomal subunit protein uL3m (Gene Name=MRPL3)

[Back to BioLiP]