Structure of PDB 6eri Chain BM

Receptor sequence
>6eriBM (length=111) Species: 3562 (Spinacia oleracea) [Search protein sequence]
VRVGNVEIPNNKRVEYSLQYIHGIGRSRARQILCDLTLENKLTKELSEDE
LLQVRDEVTKYMIEGDLRRFNAIAIRRLKEIQCYRGVRHIQGLPCRGQRT
KNNCRTLKRGK
3D structure
PDB6eri Structure of the chloroplast ribosome with chl-RRF and hibernation-promoting factor.
ChainBM
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BM K59 R60 Y63 H69 G70 I71 G72 S74 R75 Y131 R135 P141 C142 R143 Q145 R146 T147 K148 N149 N150 C151 R152 T153 K155 R156 K12 R13 Y16 H22 G23 I24 G25 S27 R28 Y84 R88 P94 C95 R96 Q98 R99 T100 K101 N102 N103 C104 R105 T106 K108 R109
BS02 MG BM Q66 I71 Q19 I24
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6eri, PDBe:6eri, PDBj:6eri
PDBsum6eri
PubMed29610536
UniProtP82163|RR13_SPIOL Small ribosomal subunit protein uS13c (Gene Name=RPS13)

[Back to BioLiP]