Structure of PDB 4v9g Chain BM

Receptor sequence

>4v9gBM (length=304) Species: 1063 (Cereibacter sphaeroides)

AEYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNP
FHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
HGMA

3D structure

• PDB: 4v9g Three-Dimensional Structure of the Rhodobacter sphaeroides RC-LH1-PufX Complex: Dimerization and Quinone Channels Promoted by PufX.
• Chain: BM
• Resolution: 7.78 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	BM	W157 L160 V175 T186	W157 L160 V175 T186
BS02	BCL	BM	I206 Y210	I206 Y210
BS03	BPH	BM	Y210 A213 L214 M218 W252 M256	Y210 A213 L214 M218 W252 M256
BS04	BCL	BM	V126 A153 I154 L156 W157 T186 S190 F197 H202 S205 I206 Y210 T277 I284	V126 A153 I154 L156 W157 T186 S190 F197 H202 S205 I206 Y210 T277 I284
BS05	BPH	BM	S59 G63 W129 A149 F150 A273	S59 G63 W129 A149 F150 A273

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:4v9g, PDBe:4v9g, PDBj:4v9g
• PDBsum: 4v9g
• PubMed: 24131108
• UniProt: P0C0Y9|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)