Structure of PDB 4v8y Chain BM

Receptor sequence
>4v8yBM (length=137) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
STDSIVKASNWRLVEVGRVVLIKKGQSAGKLAAIVEIIDQKKVLIDGPKA
GVPRQAINLGQVVLTPLTFALPRGARTATVSKKWAAAAVCEKWAASSWAK
KIAQRERRAALTDFERFQVMVLRKQKRYTVKKALAKA
3D structure
PDB4v8y Molecular architecture of a eukaryotic translational initiation complex.
ChainBM
Resolution4.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BM I6 W12 R13 K42 N59 P73 R74 R77 A79 T80 K83 K84 S98 W99 K102 R106 R109 M121 V122 R124 K125 Q126 R128 Y129 K132 K133 K137 I5 W11 R12 K41 N58 P72 R73 R76 A78 T79 K82 K83 S97 W98 K101 R105 R108 M120 V121 R123 K124 Q125 R127 Y128 K131 K132 K136
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000470 maturation of LSU-rRNA
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0032991 protein-containing complex
GO:0043232 intracellular non-membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8y, PDBe:4v8y, PDBj:4v8y
PDBsum4v8y
PubMed24200810
UniProtP38754|RL14B_YEAST Large ribosomal subunit protein eL14B (Gene Name=RPL14B)

[Back to BioLiP]