Structure of PDB 4v8d Chain BM

Receptor sequence

>4v8dBM (length=138) Species: 300852 (Thermus thermophilus HB8)

MKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGD
FVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLE
HAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKL

3D structure

• PDB: 4v8d A new understanding of the decoding principle on the ribosome.
• Chain: BM
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BM	T3 V5 W13 G24 R25 T28 K37 N45 F51 T63 G64 K65 K66 Q69 K70 R74 Y75 S76 Y78 G80 R97 E100 H101 A102 G105 M106 P111 L112 R114 K118 P129 Q131	T3 V5 W13 G24 R25 T28 K37 N45 F51 T63 G64 K65 K66 Q69 K70 R74 Y75 S76 Y78 G80 R97 E100 H101 A102 G105 M106 P111 L112 R114 K118 P129 Q131

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8d, PDBe:4v8d, PDBj:4v8d
• PDBsum: 4v8d
• PubMed: 22437501
• UniProt: P60488|RL13_THET8 Large ribosomal subunit protein uL13 (Gene Name=rplM)