Structure of PDB 4v6s Chain BM

Receptor sequence

>4v6sBM (length=128) Species: 562 (Escherichia coli)

AKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSG
FRGSRKSTPFAAQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALN
AAGFRITNITDVTPIPHNGCRPPKKRRV

3D structure

• PDB: 4v6s Structural characterization of mRNA-tRNA translocation intermediates.
• Chain: BM
• Resolution: 13.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BM	P4 I5 R6 K9	P4 I5 R6 K9
BS02	rna	BM	K13 H21 F26 N27 N28 I30 G38 N39 A40 W43 T45 G47 R52 G53 S54 K86 P114 P116 H117 N118 G119 C120 R121 K124 K125 R126 R127 V128	K13 H21 F26 N27 N28 I30 G38 N39 A40 W43 T45 G47 R52 G53 S54 K86 P114 P116 H117 N118 G119 C120 R121 K124 K125 R126 R127 V128

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6s, PDBe:4v6s, PDBj:4v6s
• PDBsum: 4v6s
• PubMed: 22467828
• UniProt: P0A7R9|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)