Structure of PDB 4v6i Chain BM

Receptor sequence

>4v6iBM (length=131) Species: 4932 (Saccharomyces cerevisiae)

QGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGD
MVMATVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANPK
GEMKGSAITGPVGKECADLWPRVASNSGVVV

3D structure

• PDB: 4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
• Chain: BM
• Resolution: 8.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BM	G65 P67 R70	G59 P61 R64
BS02	rna	BM	R12 S14 G16 A21 I22 Y35 I37 A38 V39 K40 G41 G43 S44 R45 L46 N47 R48 L49 P50 M59 T61 R70 K71 V73 A82 K83 R86 F92	R6 S8 G10 A15 I16 Y29 I31 A32 V33 K34 G35 G37 S38 R39 L40 N41 R42 L43 P44 M53 T55 R64 K65 V67 A76 K77 R80 F86

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed May 7 01:17:08 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1471                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1472         else:

=> 1473             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1474     

   1475     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v6i', asym_id = 'BM', title = 'Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v6i', asym_id='BM', title='Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.')

    840 

    841     if go:

=>  842         display_go(go,uniprot,pdbid,asym_id)

    843     return pubmed,uniprot

    844 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v6i', asym_id = 'BM'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v6i', asym_id='BM')

    481         '''.replace("$namespace_link",namespace_link

    482           ).replace("$namespace",namespace

=>  483           ).replace("$uniprot",u

    484         ))

    485         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>