Structure of PDB 4v4z Chain BM

Receptor sequence

>4v4zBM (length=139) Species: 300852 (Thermus thermophilus HB8)

KTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDF
VVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLEH
AVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV

3D structure

• PDB: 4v4z Structural basis for messenger RNA movement on the ribosome.
• Chain: BM
• Resolution: 4.51 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BM	K2 T3 V5 L23 G24 R25 T28 T32 F51 T63 K65 E68 Y72 T73 R74 Y75 Y78 P79 L82 K83 R97 H101 A102 G105 M106 P108 K109 P111 L112 R114 K121 A132 Q133 R134 P135	K1 T2 V4 L22 G23 R24 T27 T31 F50 T62 K64 E67 Y71 T72 R73 Y74 Y77 P78 L81 K82 R96 H100 A101 G104 M105 P107 K108 P110 L111 R113 K120 A131 Q132 R133 P134

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v4z, PDBe:4v4z, PDBj:4v4z
• PDBsum: 4v4z
• PubMed: 17051149
• UniProt: P60488|RL13_THET8 Large ribosomal subunit protein uL13 (Gene Name=rplM)