Structure of PDB 4xej Chain BL35

Receptor sequence

>4xejBL35 (length=63) Species: 262724 (Thermus thermophilus HB27)

PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLA
KPEAERIKLLLPY

3D structure

• PDB: 4xej Initiation of translation in bacteria by a structured eukaryotic IRES RNA.
• Chain: BL35
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BL35	P2 K3 M4 K5 T6 H7 K8 G9 K11 K12 R13 K15 T17 A18 S19 K26 T27 G28 K29 R30 H31 L32 N33 W34 Q35 S37 G38 K39 R42 Q43 K47 F48 L50 E56 K59 L62 P63 Y64	P1 K2 M3 K4 T5 H6 K7 G8 K10 K11 R12 K14 T16 A17 S18 K25 T26 G27 K28 R29 H30 L31 N32 W33 Q34 S36 G37 K38 R41 Q42 K46 F47 L49 E55 K58 L61 P62 Y63

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4xej, PDBe:4xej, PDBj:4xej
• PDBsum: 4xej
• PubMed: 25652826
• UniProt: Q72L77|RL35_THET2 Large ribosomal subunit protein bL35 (Gene Name=rpmI)